PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00040.185
Common NameAMTR_s00040p00189460, LOC18441380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRF
Protein Properties Length: 415aa    MW: 45199.7 Da    PI: 9.3825
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00040.185genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC802.3e-25133177145
                                       WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                               daepgrCrRtDGKkWRCsr+v+ g+k+CErH+hrgr+rsrk++e+
  evm_27.model.AmTr_v1.0_scaffold00040.185 133 DAEPGRCRRTDGKKWRCSREVVNGHKYCERHMHRGRNRSRKPVET 177
                                               79****************************************985 PP

2QLQ58.12.7e-2070105136
                                       QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                                               s+F+ aQ+++L++Q+l++Ky++a++PvP +L+++i+
  evm_27.model.AmTr_v1.0_scaffold00040.185  70 SPFNMAQWHELEQQALIFKYMMAGAPVPLDLVLPIR 105
                                               89*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.0E-1170106IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.02271106IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-1471105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.701133177IPR014977WRC domain
PfamPF088791.9E-21134176IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MDQQWRLHQS EHQQEQSNQP SAKLLKLSDE ASEAPPSALP LFVRDSTSVL SLSDAFKSPR  60
LGVMGQVSRS PFNMAQWHEL EQQALIFKYM MAGAPVPLDL VLPIRSSVLG LPSFYHPYHH  120
YQPSILQFGR SIDAEPGRCR RTDGKKWRCS REVVNGHKYC ERHMHRGRNR SRKPVETVAN  180
ATASTTATST IPNNVTASNS NGNISNNPPS KPFTLSPSNS NPLHQPRYAS GQNSGSWLPE  240
NSFSGREPAG KADGQILRHF FDDWPRSSGH QNPTNPNTDS SSSTHLTISI RASANPSSDF  300
SLKLSTGDSL LPSNNENGNR PTENWMVWES PLAEALRSST STPTPSDQIK GGSLWNSTNS  360
LSTTTNSNSC SNRNGASMPN STATTPTSTR VESSPTSVLH KPYGSISETS SAST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851561.10.0PREDICTED: growth-regulating factor 4
TrEMBLW1PSZ60.0W1PSZ6_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9959611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.14e-51growth-regulating factor 4
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]